SAB1403653

Monoclonal Anti-CDC25C antibody produced in mouse

clone 3B11, ascites fluid

• Synonim(y): CDC25
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: ELISA (i); WB
• klon: 3B11, monoclonal
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1:500-1:1000

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: ascites fluid
• rodzaj przeciwciała: primary antibodies
• klon: 3B11, monoclonal
• masa cząsteczkowa: antigen ~38.1 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1:500-1:1000
• izotyp: IgG1κ
• numer dostępu NCBI: BC019089
• numer dostępu UniProt: P30307
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CDC25C(995)

Opis

Opis ogólny

This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. (provided by RefSeq)

Immunogen

CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST

Postać fizyczna

Clear solution

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable