SAB1402786

Monoclonal Anti-GGTLA1, (C-terminal) antibody produced in mouse

clone 3E10, ascites fluid

• Synonim(y): DKFZp566O011, FLJ92733, GGT-REL, GGTLA1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: ascites fluid
• rodzaj przeciwciała: primary antibodies
• klon: 3E10, monoclonal
• masa cząsteczkowa: antigen ~34.58 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1:500-1:1000
• izotyp: IgMκ
• numer dostępu NCBI: NM_004121
• numer dostępu UniProt: P36269
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... GGT5(2687)

Opis

Opis ogólny

This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn′t convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

GGTLA1 (NP_004112.1, 510 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY

Postać fizyczna

Clear solution

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable