SAB1402753

Monoclonal Anti-DOCK1 antibody produced in mouse

clone 3D10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): DOCK180, ced5
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3D10, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~37.77 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu NCBI: NM_001380
• numer dostępu UniProt: Q14185
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... DOCK1(1793)

Opis

Opis ogólny

This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. (provided by RefSeq)

Immunogen

DOCK1 (NP_001371, 698 a.a. ~ 803 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable