Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

SAB1402522

Sigma-Aldrich

Monoclonal Anti-PITRM1 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

Synonim(y):

KIAA1104, MGC138192, MGC141929, MP1, PreP, hMP1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

1H3, monoclonal

Postać

buffered aqueous solution

masa cząsteczkowa

antigen ~84.48 kDa

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PITRM1(10531)

Immunogen

PITRM1 (AAH01150, 1 a.a. ~ 534 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPENPKIAKDPSWIIR

Działania biochem./fizjol.

PITRM1 (Pitrilysin metallopeptidase 1) acts as a mitochondrial amyloid-β peptide (Aβ)-degrading enzyme localized in the mitochondrial matrix. Its activity is controlled by Zn(+2)-dependent metalloprotease inhibitor. The temporal lobe of the human brain has a high tendency of Aβ accumulation and reactive oxygen species (ROS) production. In Alzheimer′s disease, the low proteolytic activity of PITRM1 in the brain mitochondria has been reported. Studies have been suggested that high ROS production results in decreased PITRM1 activity followed by Aβ accumulation. As a result, it leads to the mitochondrial toxicity and neuronal death. Thus, it proves the impact of PITRM1 in the Alzheimer′s disease.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Nyosha Alikhani et al.
Journal of Alzheimer's disease : JAD, 27(1), 75-87 (2011-07-14)
Accumulation of amyloid-β peptide (Aβ), the neurotoxic peptide implicated in the pathogenesis of Alzheimer's disease (AD), has been shown in brain mitochondria of AD patients and of AD transgenic mouse models. The presence of Aβ in mitochondria leads to free
N Mzhavia et al.
DNA and cell biology, 18(5), 369-380 (1999-06-09)
A novel cDNA, designated human metalloendoprotease 1 (hMP1), was identified on the basis of homology to known metalloendoproteases of the pitrilysin family. The full-length MP1 codes for a protein with an open reading frame of 1038 amino acids. The N-terminal
Catarina Moreira Pinho et al.
Neuroscience letters, 469(2), 204-208 (2009-12-08)
Several studies suggest mitochondrial dysfunction as a possible mechanism underlying the development of Alzheimer disease (AD). There is data showing that amyloid-beta (A beta) peptide is present in AD brain mitochondria. The human presequence protease (hPreP) was recently shown to

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej