SAB1400387

Anti-MAD2L2 antibody produced in rabbit

IgG fraction of antiserum, buffered aqueous solution

• Synonim(y): Anti-MAD2B, Anti-REV7
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: WB
• klon: polyclonal
• reaktywność gatunkowa: human
• citations: 1
• metody: western blot: 1 μg/mL

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu UniProt: Q9UI95
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MAD2L2(10459)

Opis

Opis ogólny

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. (provided by RefSeq)

Immunogen

MAD2L2 (AAH15244.1, 1 a.a. ~ 211 a.a) full-length human protein.

Sequence
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable