SAB1400307

Anti-HSD17B8 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Synonim(y): Anti-D6S2245E, Anti-FABG, Anti-FABGL, Anti-H2-KE6, Anti-HKE6, Anti-KE6, Anti-RING2, Anti-dJ1033B10.9
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: WB
• klon: polyclonal
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu UniProt: Q92506
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HSD17B8(7923)

Opis

Opis ogólny

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. (provided by RefSeq)

Immunogen

HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.

Sequence
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable