SAB1400187

Monoclonal Anti-NME2 antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-MGC111212, Anti-NDPKB, Anti-NM23B, Anti-NM23H2, Anti-puf
• Numer MDL: MFCD01865221
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: ELISA (i); IF; IHC (p); WB
• klon: 1D3, monoclonal
• reaktywność gatunkowa: human, mouse, rat
• citations: 1
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1D3, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human, mouse, rat
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotyp: IgG3κ
• numer dostępu UniProt: P22392
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• informacje o genach: human ... NME2(4831)

Opis

Opis ogólny

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of ′A′ (encoded by NME1) and ′B′ (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

Immunogen

NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable