MSST0063

SILu^™Prot IGF-1, Insulin Growth Factor -1 human

recombinant, expressed in E. coli, SIL MS Protein Standard, ¹⁵N-labeled

• Synonim(y): IGF-A, Human, Insulin Growth Factor-I, Human, Insulin-Like Growth Factor-I, Human, Insulin-like growth factor I, Myotrophin, SM-C, Somatomedin 1, Sulfation Factor C, rhIGF-I
• Kod UNSPSC: 23201100
• NACRES: NA.12

Właściwości

• rekombinowane: expressed in E. coli
• Poziom jakości: 200
• Próba: ≥95% (SDS-PAGE)
• Postać: lyophilized
• siła działania: ≥97% (Heavy amino acids incorporation efficiency by MS)
• przydatność: suitable for mass spectrometry (standard)
• numer dostępu UniProt: P05019 (Gly49-Ala118)
• Warunki transportu: ambient
• temp. przechowywania: −20°C

Opis

Opis ogólny

SILu^™Prot IGF-1 is a recombinant, stable ¹⁵N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILu^™Prot IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

Działania biochem./fizjol.

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Sekwencja

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Postać fizyczna

Supplied as a lyophilized powder containing tris buffered saline and methionine

Informacje prawne

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable