MSST0040

SILu^™Lite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Synonim(y): IFNγ, IFN-gamma, Immune interferon, Immuneinterferon
• Kod UNSPSC: 23201100
• NACRES: NA.12

Właściwości

• pochodzenie biologiczne: human
• Poziom jakości: 200
• rekombinowane: expressed in HEK 293 cells
• Próba: ≥98% (SDS-PAGE)
• Postać: lyophilized powder
• siła działania: ≥98% Heavy amino acids incorporation efficiency by MS
• masa cząsteczkowa: calculated mol wt 17 kDa
• metody: mass spectrometry (MS): suitable
• przydatność: suitable for mass spectrometry (internal calibrator)
• numer dostępu UniProt: P01579
• temp. przechowywania: −20°C
• informacje o genach: human ... IFNG(3458)

Opis

Opis ogólny

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogen

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Działania biochem./fizjol.

SILu^™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Postać fizyczna

Lyophilized from a solution of phosphate buffered saline.

Informacje prawne

SILu is a trademark of Sigma-Aldrich Co. LLC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable