HPA045910

Anti-CRBN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-MRT2, Anti-MRT2A
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA045910
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: mouse, human, rat
• rozszerzona walidacja: RNAi knockdown; Learn more about Antibody Enhanced Validation
• metody: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sekwencja immunogenna: EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
• numer dostępu UniProt: Q96SW2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CRBN(51185)

Opis

Opis ogólny

The gene CRBN (cereblon) is mapped to human chromosome 3p26.2. It is strongly expressed in the brain. The encoded protein has a conserved Lon (ATP-dependent protease La) domain. The CRBN protein is present in the cytoplasm and nucleus.
CRBN protein interacts with:

• DDB1 (anti-DDB1 HPA068456)
• SLC16A1 (anti-SLC16A1 HPA071055)
• BSG (anti-BSG HPA036048)
• PSMB4 (anti-PSMB4 HPA006700)
• PRKAA1 (anti-PRKAA1 HPA064946)

Immunogen

cereblon recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-CRBN antibody produced in rabbit has been used in western blotting.

Anti-CRBN antibody produced in rabbit has been used in immunohistochemistry

Działania biochem./fizjol.

CRBN (cereblon) mainly recruits substrates for E3 ubiquitin ligase. It interacts with BKCa (calcium-activated potassium channel subunit α-1), ClC-2 (chloride channel protein 2), AMPK (5′-AMP-activated protein kinase), PSMB4 (proteasome subunit β 4), ikaros (IKZF1), aiolos (IKZF3) and MEIS2 (Meis1-related protein). These interactions might be required for sending the proteins for ubiquitination by the E3 ubiquitin ligase. Degradation of IKZF1 (ikaros family zinc finger protein 1) and IKZF3 by lenalidomide (immunomodulatory drug)-bound CRBN helps in anti-myeloma effect of lenalidomide. Similarly, treatment with thalidomide in CRBN positive cells is effective in elderly patients with multiple myeloma. CRBN might also be associated with autosomal recessive nonsyndromic intellectual disability.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST79292

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable