HPA029691
Anti-SIRT4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Synonim(y):
Anti-SIR2L4, Anti-sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
recombinant expression
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sekwencja immunogenna
VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... SIRT4(23409)
Opis ogólny
SIRT4 (sirtuin 4) belongs to sirtuin family of nicotinamide adenine dinucleotide-dependent enzymes. It is a NAD+-dependent ADP ribosyltransferase, that is located in the mitochondria. SIRT4 protein level is found to be more in ESCC (esophageal squamous cell carcinoma) tissues.
Immunogen
sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Zastosowanie
Anti-SIRT4 has been used in immunohistochemistry.
Działania biochem./fizjol.
SIRT4 (sirtuin 4) may involve in the development of esophageal cancer. Growth of HeLa cells can be suppressed by the overexpression of SIRT4. It modulates glutamine metabolism and may also act as a tumor suppressor. It plays some important roles in multiple cellular processes like stress response and longevity. It may act as an important therapeutic target in colorectal cancer.
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST78151
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Tumour-suppressive function of SIRT4 in human colorectal cancer
Miyo M, et al.
British Journal of Cancer, 113(3), 492-499 (2015)
Kristin A Anderson et al.
Cell metabolism, 25(4), 838-855 (2017-04-06)
Sirtuins are NAD+-dependent protein deacylases that regulate several aspects of metabolism and aging. In contrast to the other mammalian sirtuins, the primary enzymatic activity of mitochondrial sirtuin 4 (SIRT4) and its overall role in metabolic control have remained enigmatic. Using
SIRT4 is upregulated in Chinese patients with esophageal cancer
Lai X, et al.
International Journal of Clinical and Experimental Pathology, 9(10), 10543-10549 (2016)
Zhouxun Chen et al.
OncoTargets and therapy, 12, 2397-2408 (2019-04-18)
SIRT4, a protein localized in the mitochondria, is one of the least characteristic members of the sirtuin family. It is known that SIRT4 has deacetylase activity and plays a role in energy metabolism, but little is known about its possible
β-Cell-specific ablation of sirtuin 4 does not affect nutrient-stimulated insulin secretion in mice.
Frank K Huynh et al.
American journal of physiology. Endocrinology and metabolism, 319(4), E805-E813 (2020-09-01)
Sirtuins are a family of proteins that regulate biological processes such as cellular stress and aging by removing posttranslational modifications (PTMs). We recently identified several novel PTMs that can be removed by sirtuin 4 (SIRT4), which is found in mitochondria.
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej