HPA023861

Anti-AFMID antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Synonim(y): Anti-KF, Anti-Kynurenine formamidase, Anti-Probable arylformamidase
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA023861
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: recombinant expression; Learn more about Antibody Enhanced Validation
• metody: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• sekwencja immunogenna: VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
• numer dostępu UniProt: Q63HM1
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... AFMID(125061)

Opis

Opis ogólny

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3. AFMID catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine.

Immunogen

Probable arylformamidase recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-AFMID antibody produced in rabbit may be used for the detection of AFMID protein in western blotting.

Działania biochem./fizjol.

The conversion of tryptophan to nicotinic acid is catalysed by kynurenine formamidase. Alternative splicing in kynurenine formamidase gene modulates tumor suppressor p53 role in hepatocellular carcinoma development and progression. Indoleamine 2,3-dioxygenase-mediated kynurenine formation could play a role in cataract formation related to chronic inflammation.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST75936

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable