HPA016908

Anti-NEK11 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-Never in mitosis A-related kinase 11, Anti-NimA-related protein kinase 11, Anti-Serine/threonine-protein kinase Nek11
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA016908
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• sekwencja immunogenna: DFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMC
• numer dostępu UniProt: Q8NG66
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NEK11(79858)

Opis

Opis ogólny

NEK11 (NIMA-related kinase 11) is a checkpoint-associated protein kinase belonging to the NIMA (never in mitosis gene A) family. It is localized at the nucleoli. NEK11 has two isoforms, NIMA-related kinase 11 Long and Short isoform.

Immunogen

Serine/threonine-protein kinase Nek11 recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

NEK11 (NIMA-related kinase 11) is highly involved in the DNA replications and DNA damage stress response. In G(1)/S-arrested cells, activated NEK11 plays several important role in nucleolar activities. It also slows down the CDC25A degradation rate by phosphorylating its specific positions during DNA damage checkpoint signaling. It has been reported that Nek11 plays a role in the S-phase checkpoint downstream of the caffeine-sensitive pathway.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71413

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)