HPA014245

Anti-MYOF antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-FER1L3, Anti-Fer-1-like protein 3, Anti-Myoferlin
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA014245

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: mouse, human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sekwencja immunogenna: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
• numer dostępu UniProt: Q9NZM1
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MYOF(26509)

Opis

Opis ogólny

The gene MYOF (myoferlin) encodes a type II membrane protein that shares homology with dysferlin. It is predominantly expressed in developing muscle and extensively in cardiac muscle. It is a member of the ferlin family of proteins. These proteins contain C2 domains that are important in calcium-mediated membrane fusion events. Myoferlin is found to be associated with both plasma membrane and nuclear membrane.

Immunogen

Myoferlin recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-MYOF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

Myoferlin is involved in the fusion of endomembrane with the plasma membrane in muscle cells and endothelial cells. It forms a complex with dynamin-2 (Dyn-2) and promotes the surface expression of vascular endothelial growth factor receptor 2. The protein complex of myoferlin-Dyn-2-Cav-1 (caveolin-1) participates in the processes of membrane fusion and fission. Myoferlin is also implicated in receptor-dependent endocytosis. It is crucial for muscle development and regeneration, and its expression is found to increase in skeletal muscle on injury. It participates in vesicle recycling and its deficiency can lead to accumulation of transferrin in the perinuclear endocytic recycling compartment in the myoblasts. It regulates postnatal muscle growth mediated by IGF1 (insulin-like growth factor 1).

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71990

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)