Przejdź do zawartości
Merck
Wszystkie zdjęcia(6)

Kluczowe dokumenty

HPA011026

Sigma-Aldrich

Anti-ARHGEF11 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-PDZ-RhoGEF, Anti-Rho guanine nucleotide exchange factor 11

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Postać

buffered aqueous glycerol solution

reaktywność gatunkowa

human

rozszerzona walidacja

recombinant expression
independent
Learn more about Antibody Enhanced Validation

metody

immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

sekwencja immunogenna

LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ARHGEF11(9826)

Opis ogólny

ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) belongs to the family of Rho guanine nucleotide exchange factors (GEFs). It shares homology to ARHGEF1 and ARHGEF12, and regulates G-protein signaling. This gene maps to human chromosome 1q21, and is expressed in a wide range of tissues such as, adipose tissue, liver, pancreas and muscle. This protein contains a PDZ (PSD-95, Disc-large, ZO1) domain and a G protein signaling (RGS) domain.

Immunogen

Rho guanine nucleotide exchange factor 11 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-ARHGEF11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Działania biochem./fizjol.

ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) induces Rho-GTPases, which modulate G protein signaling. It is involved in the regulation of lipid metabolism, insulin secretion and signaling. It also plays a part in axonal guidance. ARHGEF11 contains an actin-binding domain, and therefore, may play a role in determining the structure of actin cytoskeleton. R1467H variant of this gene might be responsible for increased susceptibility to type 2 diabetes mellitus in Chinese and German Caucasian population. It also interacts with RhoA, myosin II, and actomyosin, to establish cell polarity.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST70694

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Emil Rozbicki et al.
Nature cell biology, 17(4), 397-408 (2015-03-31)
Primitive streak formation in the chick embryo involves large-scale highly coordinated flows of more than 100,000 cells in the epiblast. These large-scale tissue flows and deformations can be correlated with specific anisotropic cell behaviours in the forming mesendoderm through a
Jing Liu et al.
Molecular biology reports, 38(4), 2499-2505 (2011-01-07)
The human Rho guanine nucleotide exchange factor 11 (ARHGEF11), located on chromosome 1q21, is an activator of Rho GTPases involved in G protein signaling pathway known to regulate insulin secretion and action. The aim of our study was to evaluate
Meiying Zheng et al.
BMC structural biology, 9, 36-36 (2009-05-23)
The Dbl-family of guanine nucleotide exchange factors (GEFs) activate the cytosolic GTPases of the Rho family by enhancing the rate of exchange of GTP for GDP on the cognate GTPase. This catalytic activity resides in the DH (Dbl-homology) domain, but
Jayashree Banerjee et al.
Biochemistry, 48(33), 8032-8043 (2009-07-22)
PDZ-RhoGEF is a member of the regulator family of G protein signaling (RGS) domain-containing RhoGEFs (RGS-RhoGEFs) that link activated heterotrimeric G protein alpha subunits of the G12 family to activation of the small GTPase RhoA. Unique among the RGS-RhoGEFs, PDZ-RhoGEF
Yvonne Böttcher et al.
Journal of human genetics, 53(4), 365-367 (2008-01-31)
The human rho guanine nucleotide exchange factor 11 (ARHGEF11) functions as an activator of rho GTPases and is supposed to influence insulin signalling. We investigated the effects of the previously reported R1467H variant in individual's susceptibility to type 2 diabetes

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej