HPA003396

Anti-ABCD4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-ATP-binding cassette sub-family D member 4 antibody produced in rabbit, Anti-P70R antibody produced in rabbit, Anti-PMP69 antibody produced in rabbit, Anti-PXMP1-L antibody produced in rabbit, Anti-Peroxisomal membrane protein 1-like antibody produced in rabbit, Anti-Peroxisomal membrane protein 69 antibody produced in rabbit
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA003396
• NACRES: NA.41
• klon: polyclonal
• application: IHC
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:200- 1:500
• citations: 2

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:200- 1:500
• sekwencja immunogenna: TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK
• numer dostępu UniProt: O14678
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ABCD4(5826)

Opis

Immunogen

ATP-binding cassette sub-family D member 4 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-ABCD4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

ABCD4 (ATP-binding cassette, sub-family D (ALD), member 4) gene encodes an ATP-binding cassette (ABC) transporter that belongs to the ALD subfamily, the members of which participate in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. It is an ABC half transporter that requires a partner half transporter molecule in order to form a functional homodimeric or heterodimeric transporter. It contains a transmembrane domain and an ABC transporter or nucleotide-binding domain (NBD) that contains conserved motifs that can bind to ATP and Mg²⁺. The protein is localized to the endoplasmic reticulum and has a molar mass of 70kDa. The function of this transporter is unknown. It may play a role in the intracellular processing of cobalamin (vitamin B12). Mutations in this gene can cause an error in cobalamin metabolism.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST70648

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)