Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV54779

Sigma-Aldrich

Anti-LGALS3BP antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-90K, Anti-Lectin, galactoside-binding, soluble, 3 binding protein, Anti-MAC-2-BP

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

63 kDa

reaktywność gatunkowa

human, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

XP_001726175

numer dostępu UniProt

Q08380

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... LGALS3BP(3959)

Immunogen

Synthetic peptide directed towards the middle region of human LGALS3BP

Zastosowanie

Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

LGALS3BP (Lectin, galactoside-binding, soluble, 3 binding protein) or MAC-2-BP gene encodes a Galectin-3-binding protein localized to chromosome 17q25. It is widely expressed by keratinocytes and fibroblasts but is also present in fluids like- semen, milk, serum, tears, saliva and urine. LGALS3BP stimulates the intergrin-mediated cell adhesion. It also imposes stimulatory impact on host defense system like natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Furthermore, the encoded protein interacts specifically with galectin-1 and galectin-3 and facilitates the formation of multicell aggregates.

Sekwencja

Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

A Ullrich et al.
The Journal of biological chemistry, 269(28), 18401-18407 (1994-07-15)
Immunization of mice with conditioned media from human breast cancer cells yielded the monoclonal antibody SP-2, which recognized an antigen of approximately 90-95 kDa. This protein, designated 90K, was found to be present in the serum of healthy individuals and
N Tinari et al.
International journal of cancer, 91(2), 167-172 (2001-01-09)
The glycoprotein 90K was originally described as a tumor-secreted antigen and subsequently found to have immunostimulatory activity as well as other possible functions. This protein interacts with an endogenous lectin, galectin-3, and may play a role in tumor metastasis through
K Koths et al.
The Journal of biological chemistry, 268(19), 14245-14249 (1993-07-05)
We have purified and sequenced a secreted glycoprotein from both the human breast carcinoma cell line, SK-BR-3, and human breast milk. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2. This Mac-2 binding protein (Mac-2-BP) has

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej