Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV53653

Sigma-Aldrich

Anti-ST6GALNAC2 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-SIAT7, Anti-SIAT7B, Anti-SIATL1, Anti-ST6 -N-acetylgalactosaminide α-2,6-sialyltransferase 2, Anti-ST6GalNAII, Anti-STHM

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

42 kDa

reaktywność gatunkowa

human, horse, rat, rabbit, pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

Opis ogólny

ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase is an enzyme encoded by the ST6GALNAC2 gene in humans. It belongs to the family of sialyltransferases. It is found in various human cell lines and is also expressed in most cell types with notable exceptions for several myeloid and lymphoid cell lines.

Immunogen

Synthetic peptide directed towards the middle region of human ST6GALNAC2

Zastosowanie

Anti-ST6GALNAC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

ST6GALNAC2 is primarily expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. Overexpression of ST6GALNAC2 abolishes the cell surface HECA-452/CLA expression, reduces the number of rolling leukocytes on P- and L-selectin-bearing substrates as well as enhances the median rolling velocity of remaining cells during the synthesis of the leukocyte selectin ligand on human P-selectin glycoprotein ligand-1. Increased expression of the sialyltransferase ST6GalNAc-II indirectly reduces the galactosylation of the O-glycan substrate.

Sekwencja

Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Hitoshi Suzuki et al.
The Journal of biological chemistry, 289(8), 5330-5339 (2014-01-09)
IgA nephropathy (IgAN), the most common primary glomerulonephritis, is characterized by renal immunodeposits containing IgA1 with galactose-deficient O-glycans (Gd-IgA1). These immunodeposits originate from circulating immune complexes consisting of anti-glycan antibodies bound to Gd-IgA1. As clinical disease onset and activity of
Georgia Sotiropoulou et al.
Molecular medicine (Cambridge, Mass.), 8(1), 42-55 (2002-05-02)
We sought to identify genes with altered expression during human breast cancer progression by applying mRNA comparisons of normal and tumor mammary cell lines with increasingly malignant phenotypes. The gene encoding a new sialyltransferase (STM) was found to be down-regulated
B Samyn-Petit et al.
Biochimica et biophysica acta, 1474(2), 201-211 (2000-04-01)
A cDNA clone encoding a human Galbeta1-3GalNAc alpha2, 6-sialyltransferase (designated hST6GalNAc II) was identified employing the PCR with degenerated primers to the sialylmotifs, followed by BLAST analysis of databanks. This sialyltransferase sequence is similar to that of previously cloned ST6GalNAc
Chi Y Lo et al.
The Journal of biological chemistry, 288(20), 13974-13987 (2013-04-04)
The binding of selectins to carbohydrate ligands expressed on leukocytes regulates immunity and inflammation. Among the human selectin ligands, the O-linked glycans at the N-terminus of the leukocyte cell-surface molecule P-selectin glycoprotein ligand-1 (PSGL-1, CD162) are important because they bind
Milan Raska et al.
Journal of molecular biology, 369(1), 69-78 (2007-04-10)
Glycosylation defects occur in several human diseases. In IgA nephropathy, IgA1 contains O-glycans that are galactose-deficient and consist mostly of core 1 alpha2,6 sialylated N-acetylgalactosamine, a configuration suspected to prevent beta1,3 galactosylation. We confirmed the same aberrancy in IgA1 secreted

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej