Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV53602

Sigma-Aldrich

Anti-LDHC antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-LDH3, Anti-LDHX, Anti-Lactate dehydrogenase C, Anti-MGC111073

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41
klon:
polyclonal
application:
WB
reaktywność gatunkowa:
rabbit, dog, horse, rat, human, mouse
metody:
western blot: suitable
citations:
7

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

36 kDa

reaktywność gatunkowa

rabbit, dog, horse, rat, human, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... LDHC(3948)

Opis ogólny

LDHC (lactate dehydrogenase C) gene also referred to as LDH3, LDHX or MGC111073 encodes for an enzyme that belongs to the lactate dehydrogenase family.

Immunogen

Synthetic peptide directed towards the middle region of human LDHC

Zastosowanie

Anti-LDHC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

LDHC is testis-specific and acts as a key enzyme for sperm motility. It facilitates the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. Additionally, it also serves as a diagnostic marker for chronic tuberculosis. 3 LDH works to prevent muscular failure and fatigue in multiple ways.

Sekwencja

Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Tahereh Esmaeilpour et al.
Iranian journal of medical sciences, 39(1), 20-28 (2014-01-24)
Application of follicular fluid (FF) and platelet-activating factor (PAF) in artificial insemination improves sperm motility. Lactate dehydrogenase C (LDH-C) is a key enzyme for sperm motility. In this study, the effects of FF and PAF on the sperm motility index
Lin Huang et al.
Animal biotechnology, 23(2), 114-123 (2012-04-28)
The objective of the present study was to confirm the widespread existence of alternative splicing of lactate dehydrogenase c (ldhc) gene in mammals. RT-PCR was employed to amplify cDNAs of ldhc from testes of mammals including pig, dog, rabbit, cat
Fanny Odet et al.
Biology of reproduction, 79(1), 26-34 (2008-03-28)
The lactate dehydrogenase (LDH) protein family members characteristically are distributed in tissue- and cell type-specific patterns and serve as the terminal enzyme of glycolysis, catalyzing reversible oxidation reduction between pyruvate and lactate. They are present as tetramers, and one family
P R Sharma et al.
Clinical biochemistry, 40(18), 1414-1419 (2007-10-16)
The objective of this investigation was to find out if sputum-positive (AFB test) test, which is performed to assess mycobacterial infection status, is anyway correlated with any of the LDH isoforms. And if so, can it be used, either alone
Fanny Odet et al.
Biology of reproduction, 85(3), 556-564 (2011-05-14)
We demonstrated previously that disruption of the germ cell-specific lactate dehydrogenase C gene (Ldhc) led to male infertility due to defects in sperm function, including a rapid decline in sperm ATP levels, a decrease in progressive motility, and a failure

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej