AV50153
Anti-PCDH15 antibody produced in rabbit
affinity isolated antibody
Synonim(y):
Anti-DFNB23, Anti-DKFZp667A1711, Anti-Protocadherin 15, Anti-RP11-449J3.2, Anti-USH1F
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
80 kDa
reaktywność gatunkowa
human, guinea pig, rat, rabbit, mouse, bovine
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... PCDH15(65217)
Opis ogólny
The gene Protocadherin-related 15 (PCDH15) is mapped to human chromosme 10q21.1. It is an integral membrane protein and one of the members of the cadherin superfamily that mediate calcium-dependent cell-cell adhesion.. PCDH15 transcripts can be detected in adult brain, lung, kidney, fetal retina and fetal cochlea.
Immunogen
Synthetic peptide directed towards the N terminal region of human PCDH15
Zastosowanie
Anti-PCDH15 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Działania biochem./fizjol.
The expression of Protocadherin-related 15 (PCDH15) is essential for normal function of cochlea and retina. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). PCDH15 is expressed in nasal NK/T-cell lymphomas.
Sekwencja
Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Yang Lyu et al.
International journal of ophthalmology, 11(5), 726-735 (2018-06-05)
To investigate the roles of integrins in choroidal neovascularization (CNV) and their associations with the stromal cell-derived factor-1 (SDF-1)/CXCR4 axis. CNV lesions were induced in mice using laser photocoagulation. After CNV induction, all animals were randomly assigned to: control, SDF-1
Xiaman Huang et al.
Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology, 33(7), 548-552 (2017-03-10)
Integrin αvβ3 (ITG αvβ3) participates in the process of implantation between the embryo and the endometrium. This study investigated the effects of prostaglandin E Quantitative real-time reverse transcription PCR (qRT-PCR) and western blotting were used to detect the changes in
Accessing neuroinflammation sites: Monocyte/neutrophil-mediated drug delivery for cerebral ischemia.
Jia Hou et al.
Science advances, 5(7), eaau8301-eaau8301 (2019-09-19)
Cerebral ischemia (CI) results from inadequate blood flow to the brain. The difficulty of delivering therapeutic molecules to lesions resulting from CI hinders the effective treatment of this disease. The inflammatory response following CI offers a unique opportunity for drug
Zubair M Ahmed et al.
Human molecular genetics, 12(24), 3215-3223 (2003-10-23)
Recessive splice site and nonsense mutations of PCDH15, encoding protocadherin 15, are known to cause deafness and retinitis pigmentosa in Usher syndrome type 1F (USH1F). Here we report that non-syndromic recessive hearing loss (DFNB23) is caused by missense mutations of
Osnat Ashur-Fabian et al.
Frontiers in endocrinology, 9, 775-775 (2019-01-24)
Ocular melanoma research, the most common primary intraocular malignancy in adults, is hindered by limited in vivo models. In a series of experiments using melanoma cells injected intraocularly into mouse eyes, we developed a model for ocular melanoma. Inoculation of
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej