Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV48972

Sigma-Aldrich

Anti-C3ORF39 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-AGO61, Anti-FLJ14566

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

66 kDa

reaktywność gatunkowa

human, dog, mouse, rat, horse, rabbit, guinea pig, bovine

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_116195

numer dostępu UniProt

Q8NAT1

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... C3orf39(84892)

Immunogen

Synthetic peptide directed towards the middle region of human C3orf39

Zastosowanie

Anti-C3ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Działania biochem./fizjol.

C3ORF39 also known as Protein O-linked mannose N-acetylglucosaminyltransferase 2 (POMGNT2; GTDC2) is a protein with glycosyltransferase activity. It is involved in the modification of O-mannosylated α-dystroglycan in the endoplasmic reticulum to generate N-acetyl glucosamine epitopes. Mutations in GTDC2 gene have been identified as the cause of Walker-Warburg syndrome.

Sekwencja

Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

M Chiara Manzini et al.
American journal of human genetics, 91(3), 541-547 (2012-09-11)
Whole-exome sequencing (WES), which analyzes the coding sequence of most annotated genes in the human genome, is an ideal approach to studying fully penetrant autosomal-recessive diseases, and it has been very powerful in identifying disease-causing mutations even when enrollment of
Mitsutaka Ogawa et al.
Biochemical and biophysical research communications, 440(1), 88-93 (2013-09-18)
Hypoglycosylation is a common characteristic of dystroglycanopathy, which is a group of congenital muscular dystrophies. More than ten genes have been implicated in α-dystroglycanopathies that are associated with the defect in the O-mannosylation pathway. One such gene is GTDC2, which
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej