AV48303

Anti-UGP2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-UDP-glucose pyrophosphorylase 2, Anti-UDPG, Anti-UDPGP2, Anti-UGPP2, Anti-pHC379
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 56 kDa
• reaktywność gatunkowa: horse, rabbit, bovine, mouse, human, dog, guinea pig, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_001001521
• numer dostępu UniProt: Q16851-2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... UGP2(7360)

Opis

Opis ogólny

UDP-glucose pyrophosphorylase 2 (UGP2) is an intermediary enzyme that transports glucose from glucose-1-phosphate to MgUTP. Studies in pigs have revealed that UGP2 is highly expressed in the liver and skeletal muscle cells.
Rabbit Anti-UGP2 antibody recognizes zebrafish, canine, chicken, bovine, pig, human, mouse, and rat UGP2.

Immunogen

Synthetic peptide directed towards the N terminal region of human UGP2

Zastosowanie

Rabbit Anti-UGP2 antibody is suitable for western blot applications at a concentration of 0.25μg/ml.

Działania biochem./fizjol.

UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Sekwencja

Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable