AV48273

Anti-ALDOC antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ALDC, Anti-Aldolase C, fructose-bisphosphate
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 39 kDa
• reaktywność gatunkowa: dog, rat, human, bovine, horse, guinea pig, rabbit, mouse
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_005156
• numer dostępu UniProt: P09972
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ALDOC(230)

Opis

Opis ogólny

ALDOC codes for a class I fructose-biphosphate aldolase that catalyzes the breakdown of fructose-1,6-biphosphate to dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate during glycolysis. It also catalyzes the aldol cleavage of fructose-1 phosphate to DHAP and glyceraldehyde. ALDOC is expressed in the cerebellum, retina and other parts of the CNS. It is known to be upregulated in the brain and skeletal muscles cells of chickens during hypoxia.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.

Immunogen

Synthetic peptide directed towards the N terminal region of human ALDOC

Zastosowanie

Rabbit Anti-ALDOC antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Działania biochem./fizjol.

ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Sekwencja

Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable