Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV47013

Sigma-Aldrich

Anti-FJX1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-FLJ22416, Anti-FLJ25593, Anti-Four jointed box 1 (Drosophila)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

48 kDa

reaktywność gatunkowa

human, guinea pig, rat, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... FJX1(24147)

Immunogen

Synthetic peptide directed towards the N terminal region of human FJX1

Zastosowanie

Anti-FJX1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Działania biochem./fizjol.

FJX1 [four jointed box 1 (Drosophila)] gene encodes for a protein, which is the human ortholog of mouse and drosophila four-jointed gene product that belongs to FJX1/FJ family. Rodent four-jointed ortholog Fjx1 facilitates the regulation of dendrite extension.

Sekwencja

Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Barbara Probst et al.
Developmental biology, 312(1), 461-470 (2007-11-22)
The extrinsic and intrinsic factors that regulate the size and complexity of dendritic arborizations are still poorly understood. Here we identify Fjx1, the rodent ortholog of the Drosophila planar cell polarity (PCP) protein Four-jointed (Fj), as a new inhibitory factor
San Jiun Chai et al.
Human vaccines & immunotherapeutics, 15(1), 167-178 (2018-09-08)
Peptide vaccines derived from tumour-associated antigens have been used as an immunotherapeutic approach to induce specific cytotoxic immune response against tumour. We previously identified that MAGED4B and FJX1 proteins are overexpressed in HNSCC patients; and further demonstrated that two HLA-A2-restricted

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej