Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV46808

Sigma-Aldrich

Anti-MMP23B antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-MIFR, Anti-MIFR-1, Anti-MMP22, Anti-Matrix metallopeptidase 23B

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Numer MDL:
MFCD04040445
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

36 kDa

reaktywność gatunkowa

guinea pig, bovine, human, mouse, dog, rat, horse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_008914

numer dostępu UniProt

O75900

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... MMP23B(8510)

Powiązane kategorie

Immunogen

Synthetic peptide directed towards the N terminal region of human MMP23B

Zastosowanie

Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

MMP23B (matrix metallopeptidase 23B) gene encodes a single-pass type II membrane protein that belongs to matrix metalloproteinase (MMP) family and is expressed primarily in ovary, testis and prostate. Matrix metalloproteinase (MMP) family proteins facilitate the breakdown of extracellular matrix (ECM) components as well as processes cytokines and growth factors. Human MMP23B stimulates TNF shedding in a cell culture system. In zebrafish, Mmp23b plays a crucial role in augmenting liver development and hepatocyte proliferation via tumor necrosis factor pathway.

Sekwencja

Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

G Velasco et al.
The Journal of biological chemistry, 274(8), 4570-4576 (1999-02-13)
A cDNA encoding a new human matrix metalloproteinase (MMP), tentatively called MMP-23, has been cloned from an ovary cDNA library. This protein exhibits sequence similarity with MMPs, but displays a different domain structure. Thus, MMP-23 lacks a recognizable signal sequence
Fei Qi et al.
Hepatology (Baltimore, Md.), 52(6), 2158-2166 (2010-11-11)
The matrix metalloproteinase (MMP) family of proteins degrades extracellular matrix (ECM) components as well as processes cytokines and growth factors. MMPs are involved in regulating ECM homeostasis in both normal physiology and disease pathophysiology. Here we report the critical roles

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej