Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV46164

Sigma-Aldrich

Anti-STIP1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-HOP, Anti-IEF-SSP-3521, Anti-P60, Anti-STI1, Anti-STI1L, Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

63 kDa

reaktywność gatunkowa

rat, horse, mouse, human, dog, pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... STIP1(10963)

Immunogen

Synthetic peptide directed towards the N terminal region of human STIP1

Zastosowanie

Anti-STIP1 (AB1) antibody produced in rabbit can be used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by using western blotting at a concentration of 1.25μg/ml.

Działania biochem./fizjol.

Stress-induced-phosphoprotein 1 (STIP1) also referred to as Hsp70/Hsp90-organizing protein, HOP, STI1, STI1L or P60 is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 facilitates the interaction of chaperones Hsp70 and Hsp90 for proper protein folding. Additionally, it assists as a novel biomarker for ovarian cancer. STIP1 secreted by human ovarian cancer cells binds to a bone morphogenetic protein (BMP) receptor, ALK2 (activin A receptor, type II-like kinase 2) and activates SMAD-ID3 signaling pathways. Hence, STIP1-ALK2 pathway promotes cell proliferation in ovarian cancer cells.

Sekwencja

Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Dokumenty section.

Proszę o kontakt, jeśli potrzebna jest pomoc Obsługa Klienta

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej