Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

AV44073

Sigma-Aldrich

Anti-SLC22A16 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-6-Oct, Anti-CT2, Anti-FLIPT2, Anti-OKB1, Anti-Solute carrier family 22 (organic cation transporter), member 16, Anti-dJ261K5.1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

63 kDa

reaktywność gatunkowa

human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

Opis ogólny

The previously assigned protein identifier Q96RU0 has been merged into Q86VW1. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC22A16

Zastosowanie

Anti-SLC22A16 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Działania biochem./fizjol.

SLC22A16 (CT2; OAT6) is an organic zwitterion transporter protein that transports l-carnitine, a component of mitochondrial fatty acid beta-oxidation process. The transporter does not accept OCT/OCTN cationic or OAT anionic substrates. CT2 is specifically expressed in luminal membrane of epididymal epithelium and within the Sertoli cells of the testis. Human CT2 reportedly mediates the uptake of polyamines and the anticancer drug bleomycin-A5.

Sekwencja

Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Mustapha Aouida et al.
The Journal of biological chemistry, 285(9), 6275-6284 (2009-12-29)
Bleomycin is used in combination with other antineoplastic agents to effectively treat lymphomas, testicular carcinomas, and squamous cell carcinomas of the cervix, head, and neck. However, resistance to bleomycin remains a persistent limitation in exploiting the full therapeutic benefit of
Atsushi Enomoto et al.
The Journal of biological chemistry, 277(39), 36262-36271 (2002-06-29)
l-Carnitine is an essential component of mitochondrial fatty acid beta-oxidation and plays a pivotal role in the maturation of spermatozoa within the male reproductive tract. Epididymal plasma contains the highest levels of l-carnitine found in the human body, and initiation
Yan Wu et al.
Apoptosis : an international journal on programmed cell death, 20(8), 1099-1108 (2015-05-23)
AML (acute myeloid leukemia) cells have a unique reliance on mitochondrial metabolism and fatty acid oxidation (FAO). Thus, blocking FAO is a potential therapeutic strategy to target these malignant cells. In the current study, we assessed plasma membrane carnitine transporters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej