Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV43788

Sigma-Aldrich

Anti-SLC25A29 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-C14orf69, Anti-FLJ38975, Anti-Solute carrier family 25, member 29

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

33 kDa

reaktywność gatunkowa

human, bovine, dog, rabbit, guinea pig, horse, rat, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001034444

numer dostępu UniProt

Q8N8R3

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... SLC25A29(123096)

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC25A29

Działania biochem./fizjol.

SLC25A29 is a member of solute carrier (SLC) family 25 of transporters also called as mitochondrial carrier family. The members of this family are present in the inner mitochondrial membranes and connect cytoplasmic and mitochondrial matrices. SLC25A29 is involved in the transport of basic amino acids into the mitochondria, protein synthesis and amino acid degradation in mitochondria.

Sekwencja

Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Vito Porcelli et al.
The Journal of biological chemistry, 289(19), 13374-13384 (2014-03-22)
The human genome encodes 53 members of the solute carrier family 25 (SLC25), also called the mitochondrial carrier family, many of which have been shown to transport carboxylates, amino acids, nucleotides, and cofactors across the inner mitochondrial membrane, thereby connecting
Ferdinando Palmieri
Molecular aspects of medicine, 34(2-3), 465-484 (2012-12-26)
SLC25 is a large family of nuclear-encoded transporters embedded in the inner mitochondrial membrane and in a few cases other organelle membranes. The members of this superfamily are widespread in eukaryotes and involved in numerous metabolic pathways and cell functions.

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej