AV42290

Anti-AGR2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-AG2, Anti-Anterior gradient homolog 2 (Xenopus laevis), Anti-GOB-4, Anti-HAG-2, Anti-XAG-2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 20 kDa
• reaktywność gatunkowa: rat, dog, rabbit, human, bovine, horse, mouse, guinea pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_006399
• numer dostępu UniProt: O95994
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... AGR2(10551)

Opis

Opis ogólny

Anterior gradient homolog 2 (Xenopus laevis) (AGR2) is a protein disulfide isomerase (PDI) which aids protein folding and assembly by catalyzing formation and shuffling of cysteine disulfide bonds in the endoplasmic reticulum (ER). AGR2 is present in the ER of intestinal secretory epithelial cells and it is believed to have a role in mucin processing and colitis.

Specyficzność

Anti-AGR2 antibody polyclonal antibody reacts with the bovine, chicken, zebrafish, human, mouse, and rat anterior gradient homolog 2 (Xenopus laevis).

Immunogen

Synthetic peptide directed towards the middle region of human AGR2

Zastosowanie

Anti-anterior gradient homolog 2 (Xenopus laevis) polyclonal antibody is used to tag anterior gradient homolog 2 (Xenopus laevis) protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

Działania biochem./fizjol.

AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

Sekwencja

Synthetic peptide located within the following region: AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable