AV40734

Anti-PRPF6 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 104 kDa
• reaktywność gatunkowa: rat, human, mouse, guinea pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: XP_001713896
• numer dostępu UniProt: O94906
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... PRPF6(24148)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human PRPF6

Działania biochem./fizjol.

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Sekwencja

Synthetic peptide located within the following region: FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable