Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Kluczowe dokumenty

AV40585

Sigma-Aldrich

Anti-HNRPDL antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Heterogeneous Nuclear Ribonucleoprotein D-like

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

40 kDa

reaktywność gatunkowa

guinea pig, mouse, horse, rat, human, bovine, dog

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... HNRPDL(9987)

Opis ogólny

Heterogeneous Nuclear Ribonucleoproteins (hnRNP) are RNA binding proteins that form complexes with heterogeneous nuclear RNA (hnRNA). HnRNPs regulate pre-mRNA processing, metabolism and nuclear cytoplasmic shuttling. Specific HnRNPs have unique nucleic acid binding properties. Heterogeneous Nuclear Ribonucleoprotein D-like (JKTBP) is a DNA- and RNA-binding protein highly expressed in brain and testes tissue. JKTBP interacts with APP (β-amyloid precursor protein) creating a possible link between JKTBP and Alzheimer′s disease.

Specyficzność

Anti-HNRPDL (JKTBP) polyclonal antibody reacts with canine, zebrafish, human, chicken, rat, bovine, and mouse heterogeneous nuclear ribonucleoprotein D-like proteins.

Immunogen

Synthetic peptide directed towards the middle region of human HNRPDL

Zastosowanie

Anti-HNRPDL (JKTBP) polyclonal antibody is used to tag the heterogeneous nuclear ribonucleoprotein D-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of heterogeneous nuclear ribonucleoprotein D-like in specific mRNA shuttling and Alzheimer′s disease.

Działania biochem./fizjol.

HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Sekwencja

Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Lorena Zubović et al.
Nucleic acids research, 40(13), 6255-6269 (2012-03-22)
Mutually exclusive splicing is a form of alternative pre-mRNA processing that consists in the use of only one of a set of two or more exons. We have investigated the mechanisms involved in this process for exon 18 of the

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej