AV37145

Anti-SREBF1 (AB1) antibody produced in rabbit

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 125 kDa
• reaktywność gatunkowa: mouse, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_035610
• numer dostępu UniProt: Q9WTN3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: mouse ... SREBF1(20787)

Opis

Opis ogólny

Sterol regulatory element-binding protein 1 (SREBP1) is a member of the basic helix-loop-helix (bHLH) family of transcription factors.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse SREBF1

Działania biochem./fizjol.

Sterol regulatory element-binding protein 1 (SREBP1) regulates de novo lipogenesis. It can be used as a biomarker and a therapeutic target due to its function as an oncogene and a pro-proliferation factor in thyroid cancer. It bind to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.

Sterol regulatory element-binding transcription factor 1 (SREBF1) binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.

Sekwencja

Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable