AV35090
Anti-KCNK3 antibody produced in rabbit
IgG fraction of antiserum
Synonim(y):
Anti-Potassium channel, subfamily K, member 3
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
białko sprzężone:
unconjugated
application:
WB
klon:
polyclonal
reaktywność gatunkowa:
dog, guinea pig, rat, sheep, human, bovine, mouse
citations:
4
metody:
western blot: suitable
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
IgG fraction of antiserum
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Formularz
buffered aqueous solution
masa cząsteczkowa
43 kDa
reaktywność gatunkowa
dog, guinea pig, rat, sheep, human, bovine, mouse
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... KCNK3(3777)
Opis ogólny
KCNK3 (TASK1) is a potassium channel protein that contains pore-forming domains. ML365 is known to selectively inhibit KCNK3. It is involved in the chemosensory regulation of breathing. KCNK3 variations have been linked to BP and aldosterone production.
Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.
Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.
Immunogen
Synthetic peptide directed towards the C terminal region of human KCNK3
Zastosowanie
Rabbit Anti-KCNK3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Działania biochem./fizjol.
KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
Sekwencja
Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
ML365: Development of Bis-Amides as Selective Inhibitors of the KCNK3/TASK1 Two Pore Potassium Channel.
Zou B, et al.
SourceProbe Reports from the NIH Molecular Libraries Program [Internet]. (2013)
Jeesun Jung et al.
The Journal of clinical endocrinology and metabolism, 97(11), E2160-E2167 (2012-08-16)
Two potassium (K) channel genes, Kcnk3 and Kcnk9, when deleted in mice, produced a model of hyperaldosteronism and hypertension. Our objective was to explore genetic variation [single-nucleotide polymorphisms (SNP)] in KCNK3 and KCNK9 in relation to blood pressure (BP) and
Stefan Trapp et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 28(35), 8844-8850 (2008-08-30)
Acid-sensitive K+ channels of the tandem P-domain K+-channel family (TASK-1 and TASK-3) have been implicated in peripheral and central respiratory chemosensitivity; however, because of the lack of decisive pharmacological agents, the final proof of the role of the TASK channel
Constanze Schmidt et al.
Circulation, 132(2), 82-92 (2015-05-09)
Antiarrhythmic management of atrial fibrillation (AF) remains a major clinical challenge. Mechanism-based approaches to AF therapy are sought to increase effectiveness and to provide individualized patient care. K(2P)3.1 (TASK-1 [tandem of P domains in a weak inward-rectifying K+ channel-related acid-sensitive
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej