Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV34429

Sigma-Aldrich

Anti-USF1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Upstream transcription factor 1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41
klon:
polyclonal
application:
WB
reaktywność gatunkowa:
bovine, rat, human, dog, rabbit, horse, mouse, guinea pig
metody:
western blot: suitable
citations:
3

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

34 kDa

reaktywność gatunkowa

bovine, rat, human, dog, rabbit, horse, mouse, guinea pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... USF1(7391)

Opis ogólny

USF1 is a leucine zipper transcription factor that forms a part of complexes that interact with fatty acid synthase (FAS) insulin response sequence (IRS). Valproic acid (VPA) is known to inhibit adipogenesis by repressing USF1-induced synthesis of fatty acids. Studies have reported that USF1 gene is associated with familial combined hyperlipidemia (FCHL).
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.

Immunogen

Synthetic peptide directed towards the N terminal region of human USF1

Zastosowanie

Rabbit Anti-USF1 (AB2) can be used for western blot applications at 1.25 μg/ml.

Działania biochem./fizjol.

USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).

Sekwencja

Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

D Wang et al.
The Journal of biological chemistry, 270(48), 28716-28722 (1995-12-01)
Fatty acid synthase (FAS) plays a central role in de novo lipogenesis in mammals. The concentration or activity of FAS in liver and adipose tissue changes dramatically when animals are subjected to nutritional and hormonal manipulations. We previously reported that
Päivi Pajukanta et al.
Nature genetics, 36(4), 371-376 (2004-03-03)
Familial combined hyperlipidemia (FCHL), characterized by elevated levels of serum total cholesterol, triglycerides or both, is observed in about 20% of individuals with premature coronary heart disease. We previously identified a locus linked to FCHL on 1q21-q23 in Finnish families
Miki Yuyama et al.
The Biochemical journal, 459(3), 489-503 (2014-02-12)
VPA (valproic acid), a short-chain fatty acid that is a HDAC (histone deacetylase) inhibitor, is known to suppress adipogenesis. In the present study, we identified the molecular mechanism of VPA-mediated suppression of adipogenesis in adipocytes. VPA suppressed the accumulation of

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej