AV32765

Anti-CDX4 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Caudal type homeobox transcription factor 4
• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 30 kDa
• reaktywność gatunkowa: horse, dog, rabbit, pig, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_005184
• numer dostępu UniProt: O14627
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CDX4(1046)

Opis

Opis ogólny

Caudal related homeobox (Cdx) genes are known to modulate axial elongation and patterning in many vertebrate embryos. Cdx4 regulates the ontogenesis of placental labyrinth in mice. Furthermore, Cdx4 is known to dysregulate Hox gene expression which causes acute myeloid leukemia in mouse models.
Rabbit Anti-CDX4 antibody recognizes rat, mouse, bovine, and human CDX4.

Immunogen

Synthetic peptide directed towards the C terminal region of human CDX4

Zastosowanie

Rabbit Anti-CDX4 (AB1) antibody can be used for western blot applications at a concentration of 2.5 μg/ml.

Działania biochem./fizjol.

CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes.

Sekwencja

Synthetic peptide located within the following region: KKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable