AV32759

Anti-HMG20A (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-FLJ10739, Anti-HMGX1, Anti-High-mobility group 20A
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 40 kDa
• reaktywność gatunkowa: mouse, rat, dog, guinea pig, horse, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_060670
• numer dostępu UniProt: Q9NP66
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... HMG20A(10363)

Opis

Opis ogólny

HMG20A is a homeobox gene that is expressed ubiquitously. Studies in CHO-K1 cells have reported that it interacts with the poxvirus protein, CP77, and modulates its dissociation from the genome of vaccinia virus.
Rabbit Anti-HMG20A (AB2) antibody recognizes bovine, human, mouse, rat, and canine HMG20A.

Immunogen

Synthetic peptide directed towards the middle region of human HMG20A

Zastosowanie

Rabbit Anti-HMG20A (AB2) antibody can be used for western blot applications at 1.25 μg/ml.

Działania biochem./fizjol.

HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4

Sekwencja

Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable