AV32524

Anti-NR5A2 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2
• Numer MDL: MFCD07370495
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 36 kDa
• reaktywność gatunkowa: guinea pig, rat, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_003813
• numer dostępu UniProt: O60587
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NR5A2(2494)

Opis

Opis ogólny

NR5A2 belongs to the nuclear receptor subfamily. It has been implicated in acinar cell differentiation and pancreatic carcinogenesis.
Rabbit Anti-NR5A2 (AB2) antibody recognizes chicken, human, mouse, and rat NR5A2.

Immunogen

Synthetic peptide directed towards the middle region of human NR5A2

Zastosowanie

Rabbit Anti-NR5A2 (AB2) antibody can be used for western blot applications at a concentration of 1μg/ml.

Działania biochem./fizjol.

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Sekwencja

Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable