AV31477

Anti-SLC30A9 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Solute carrier family 30 (Zinc transporter), member 9
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 63 kDa
• reaktywność gatunkowa: rat, human, horse, guinea pig, rabbit, bovine, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_006336
• numer dostępu UniProt: Q6PML9
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC30A9(10463)

Opis

Opis ogólny

SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 (AB1) antibody recognizes rat, human, canine, mouse, pig, bovine, and zebrafish SLC30A9.

The previously assigned protein identifier Q9Y6R2 has been merged into Q6PML9. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC30A9

Zastosowanie

Rabbit Anti-SLC30A9 (AB1) antibody is suitable for use in western blot assays at a concentration of 0.5-2.0μg/ml. The antibody can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

Działania biochem./fizjol.

The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

Sekwencja

Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable