Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

AV13060

Sigma-Aldrich

Anti-GRIA2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Glutamate receptor, ionotropic, AMPA 2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41
klon:
polyclonal
application:
IHC
reaktywność gatunkowa:
rabbit, mouse, horse, bovine, rat, guinea pig, human
metody:
immunohistochemistry: suitable
citations:
4

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

99 kDa

reaktywność gatunkowa

rabbit, mouse, horse, bovine, rat, guinea pig, human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... GRIA2(2891)

Immunogen

Synthetic peptide directed towards the N terminal region of human GRIA2

Zastosowanie

Anti-GRIA2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Działania biochem./fizjol.

GRIA2 or glutamate receptor 2 (GluR2) inhibits the influx of calcium through AMPA-receptor complexes. Mutations in GRIA2 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.

Sekwencja

Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Andy N Mead et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(29), 9500-9507 (2003-10-24)
Presence of the glutamate receptor 2 (GluR2) subunit prevents calcium influx through AMPA-receptor complexes; deletion of this subunit results in enhanced hippocampal long-term potentiation. We investigated whether mice lacking the GluR2 subunit [gria2 knock-out (KO) mice] displayed impairments in learning
Alberto Chiesa et al.
European archives of psychiatry and clinical neuroscience, 262(4), 305-311 (2011-11-08)
The present study is aimed to exploring whether some single nucleotide polymorphisms (SNPs) within GRIA1, GRIA2 and GRIA4 could be associated with major depressive disorder (MDD) and whether they could predict clinical outcomes in Korean in-patients, respectively, treated with antidepressants.
Junyu Xu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(46), 15415-15424 (2014-11-14)
In the CNS, synapse formation and maturation play crucial roles in the construction and consolidation of neuronal circuits. Neurexin and neuroligin localize on the opposite sides of synaptic membrane and interact with each other to promote the assembly and specialization
Sarah L Ferri et al.
Hormones and behavior, 66(2), 409-420 (2014-07-06)
Ovarian hormones act in multiple brain regions to modulate specific behaviors and emotional states. For example, ovarian hormones promote female sexual receptivity in the hypothalamic ventromedial nucleus (VMH) and modulate anxiety in the amygdala. Hormone-induced changes within the VMH include

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej