Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV100775

Sigma-Aldrich

Anti-TCF4 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Transcription factor 4

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

71 kDa

reaktywność gatunkowa

mouse, horse, guinea pig, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001077431

numer dostępu UniProt

P15884

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... TCF4(6925)

Opis ogólny

TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.

Immunogen

Synthetic peptide directed towards the N terminal region of human TCF4

Zastosowanie

Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Działania biochem./fizjol.

TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with b-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.

Sekwencja

Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

J David Sweatt
Experimental & molecular medicine, 45, e21-e21 (2013-05-04)
TCF4 (transcription factor 4; E2-2, ITF2) is a transcription factor that when haplo-insufficient causes Pitt-Hopkins Syndrome (PTHS), an autism-spectrum disorder that is associated with pervasive developmental delay and severe intellectual disability. The TCF4 gene is also a risk factor with
Marc van de Wetering et al.
Cell, 111(2), 241-250 (2002-11-01)
The transactivation of TCF target genes induced by Wnt pathway mutations constitutes the primary transforming event in colorectal cancer (CRC). We show that disruption of beta-catenin/TCF-4 activity in CRC cells induces a rapid G1 arrest and blocks a genetic program
V Korinek et al.
Nature genetics, 19(4), 379-383 (1998-08-11)
Mutations of the genes encoding APC or beta-catenin in colon carcinoma induce the constitutive formation of nuclear beta-catenin/Tcf-4 complexes, resulting in activated transcription of Tcf target genes. To study the physiological role of Tcf-4 (which is encoded by the Tcf7/2

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej