Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV09007

Sigma-Aldrich

Anti-RGS3 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-C2PA, Anti-FLJ20370, Anti-FLJ31516, Anti-FLJ90496, Anti-PDZ-RGS3, Anti-RGP3, Anti-Regulator of G-protein signaling 3

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

101 kDa

reaktywność gatunkowa

rat, bovine, pig, human, horse, dog, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... RGS3(5998)

Powiązane kategorie

Immunogen

Synthetic peptide directed towards the C terminal region of human RGS3

Zastosowanie

Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Działania biochem./fizjol.

Regulator of G-protein signaling-3 (RGS3) accelerates the GTPase activity of G(i) and G(q) subunits. It interacts with the Smad transcription factors that are activated by TGF-β and prevents the heteromerization of Smad3 and Smad4. This results in inhibition of transcriptional activity of Smads and inhibition of TGF-β-induced differentiation of myofibroblasts. In sensory neurons, RGS3 mediates the termination of G protein signaling by calcium influx through voltage-gated channels. The role of RGS3 in collaboration with Ephrin-B is important in the maintenance of the neural progenitor cells.

Sekwencja

Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Runxiang Qiu et al.
Stem cells (Dayton, Ohio), 28(9), 1602-1610 (2010-07-16)
Ephrin-B plays an important role in neural progenitor cells to regulate self-renewal and differentiation. Cellular and embryological evidence suggest this function of ephrin-B is mediated through a PDZ-dependent reverse signaling mechanism. Here, we have genetically investigated the function of PDZ-RGS3
Douglas M Yau et al.
Molecular pharmacology, 73(5), 1356-1361 (2008-02-22)
Regulator of G protein signaling (RGS) proteins are united into a family by the presence of the homologous RGS domain that binds the alpha subunits of heterotrimeric G proteins and accelerates their GTPase activity. A member of this family, RGS3
Patrizia Tosetti et al.
Proceedings of the National Academy of Sciences of the United States of America, 100(12), 7337-7342 (2003-05-29)
G proteins modulate synaptic transmission. Regulators of G protein signaling (RGS) proteins accelerate the intrinsic GTPase activity of Galpha subunits, and thus terminate G protein activation. Whether RGS proteins themselves are under cellular control is not well defined, particularly in

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej