추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
1E2, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TOP2A(7153)
일반 설명
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. (provided by RefSeq)
면역원
TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
생화학적/생리학적 작용
Topoisomerase II A (TOP2A) enzyme plays a vital role in DNA replication and cell proliferation. Experimental studies show an increased expression of this enzyme in Chinese patients with gastric carcinoma. DNA topoisomerase 2-α acts as a target enzyme for an anthracycline drug called as epirubicin and many other antineoplastic drugs. Top2α is involved in reducing the topological stress in cells. The hsa-miR-485-3p downregulates the expression of nuclear transcription factor Y subunit β (NFYB), which acts as a mediator of Top2α. Consequently, it decreases the expression of Top2α and its drug responsiveness. Top2α enzyme plays an important role in maintenance of chromosome condensation and segregation. Ataxia telangiectasia mutated (ATM)-dependent regulation of TOP2A helps in TOP2 stability and also it′s sensitivity to TOP2 inhibitor.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Novel regulation of nuclear factor-YB by miR-485-3p affects the expression of DNA topoisomerase IIa and drug responsiveness.
Chen CF
Molecular Pharmacology, 79(4), 735-741 (2011)
RECQL5 cooperates with Topoisomerase II alpha in DNA decatenation and cell cycle progression.
Ramamoorthy M
Nucleic Acids Research, 40(4), 1621-1635 (2012)
The transcriptional regulator Aire binds to and activates super-enhancers.
Bansal K
Nature Immunology, 18(3), 263-273 (2017)
Kushagra Bansal et al.
Nature immunology, 18(3), 263-273 (2017-01-31)
Aire is a transcription factor that controls T cell tolerance by inducing the expression of a large repertoire of genes specifically in thymic stromal cells. It interacts with scores of protein partners of diverse functional classes. We found that Aire
Analysis of EGFR, HER2, and TOP2A gene status and chromosomal polysomy in gastric adenocarcinoma from Chinese patients.
Liang Z
BMC Cancer, 8, 363-363 (2008)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.