WH0004760M1

Monoclonal Anti-NEUROD1 antibody produced in mouse

clone 3H8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-BETA2, Anti-BHF1, Anti-NEUROD, Anti-neurogenic differentiation 1
• MDL number: MFCD03097085
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i); IF; IHC (p); WB
• 클론: 3H8, monoclonal
• 종 반응성: human
• citations: 4
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3H8, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC009046
• UniProt 수납 번호: Q13562
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NEUROD1(4760)

설명

일반 설명

Neuronal differentiation 1 (NeuroD1) belongs to the family of a basic helix-loop-helix transcription factor. The NEUROD1 gene is localized on human chromosome 2q31.3 and is expressed in developing neurons.

면역원

NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT

생화학적/생리학적 작용

Neuronal differentiation 1 (NeuroD1) may mediate the genesis of functional neurons from glial cells. Its higher expression favors neural differentiation in elder rats. NeuroD1 may be crucial for reversing functional impairment by favoring axonal regeneration in nerve injury. Various mutations in NEUROD1 reported have direct implications in the pathophysiology of early-onset diabetes, retinal dystrophy, nonsyndromic retinitis pigmentosa, and neurological abnormalities.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)