콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

WH0004609M2

Sigma-Aldrich

Monoclonal Anti-MYC antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-cMyc, Anti-v-Myc myelocytomatosis viral oncogene homolog (avian)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

1G7, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG3κ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MYC(4609)

일반 설명

MYC (MYC proto-oncogene) is a transcriptional factor and oncoprotein. c-myc is a member of MYC gene family. It is located on human chromosome 8q24. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor.
The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-terminal. The synthesis of non-AUG initiated protein is suppressed in Burkitt′s lymphomas, suggesting its importance in the normal function of this gene. (provided by RefSeq)

면역원

MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

생화학적/생리학적 작용

The cellular myelocytomatosis (c-myc) oncogene plays a major role in cellular proliferation, differentiation and apoptosis. It acts as transcriptional regulator of gene expression. MYC (MYC proto-oncogene) may be essential for cancer initiation, promotion and therapy resistance. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

이미 열람한 고객

Clinicopathological significance of c-MYC in esophageal squamous cell carcinoma
Lian Y, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2017)
Fei Wang et al.
Science signaling, 15(719), eabd0033-eabd0033 (2022-02-02)
Social memory enables one to recognize and distinguish specific individuals. It is fundamental to social behaviors that can be mediated by the oxytocin receptor (OXTR), such as forming relationships. We investigated the molecular regulation and function of OXTR in animal
Yimeng Yin et al.
The Biochemical journal, 452(1), 67-78 (2013-02-27)
The NXF (nuclear export factor) family members are implicated in the transport of mRNA from the nucleus to the cytoplasm. Recently, some members of the NXF family have been reported to play divergent functional roles, such as post-transcriptional regulation, translational
Francisco Ciruela et al.
The European journal of neuroscience, 32(8), 1265-1277 (2010-09-18)
The stimulation of inhibitory neurotransmitter receptors, such as γ-aminobutyric acid type B (GABA(B) ) receptors, activates G protein-gated inwardly-rectifying K(+) (GIRK) channels, which influence membrane excitability. There is now evidence suggesting that G protein-coupled receptors and G protein-gated inwardly-rectifying K(+)
MYC Protein-positive Diffuse Large B-Cell Lymphoma Features an Activated B-Cell Receptor Signal Pathway
Wang WG, et al.
American Journal of Surgical Pathology, 41(4), 541-549 (2017)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.