WH0003340M1

Monoclonal Anti-NDST1 antibody produced in mouse

clone 1G10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-HSST, Anti-N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, Anti-NST1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1G10, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_001543
• UniProt 수납 번호: P52848
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NDST1(3340)

설명

일반 설명

NDST1 (N-deacetylase and N-sulfotransferase 1) is a bifunctional enzyme that has both N-deacetylase and N-sulfotransferase activities. This gene is located on human chromosome 5q33.

면역원

NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI

생화학적/생리학적 작용

The enzyme coded by NDST1 (N-deacetylase and N-sulfotransferase 1) gene participates in the first step in the production of heparan sulfate chains and proteoglycans. This enzyme also plays a major role in generating the GlcNS (N-sulfo glucosamine) residues.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)