생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
56 kDa
종 반응성
human, rabbit, dog, rat, mouse
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
immunohistochemistry: suitable
수납 번호(accession number)
NM_024424
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... WT1(7490)
일반 설명
Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.
면역원
Synthetic peptide directed towards the middle region of human WT1
생화학적/생리학적 작용
WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.
서열
Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
The role of Wt1 in regulating mesenchyme in cancer, development, and tissue homeostasis
Chau YY and Hastie ND
Trends in Genetics, 28(10), 515-524 (2012)
New insights into DNA-binding behaviour of Wilms Tumor Protein (WT1)?A dual study
Nurmemmedov E, et al.
Biophysical Chemistry, 145(2-3), 116-125 (2009)
The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity
Rivera et al.
Proceedings of the National Academy of Sciences of the USA, 106(20), 8338-8343 (2009)
Donor splice-site mutations in WT1 are responsible for Frasier syndrome
Barbaux S, et al.
Nature Genetics, 17(4), 467-467 (1997)
Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll R, et al.
Journal of Molecular Biology, 372(5), 1227-1245 (2007)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.