추천 제품
관련 카테고리
일반 설명
Wilms tumor 1 (WT1) is a transcription factor with C-terminal zinc-finger motifs and an N-terminal proline/glutamine-rich DNA-binding domain. WT1 gene is mapped to human chromosome 11p13. WT1 expression occurs in the spleen, kidneys, gonads, and abdominal cavity lining during vertebrate development. WT1 exists as multiple transcript variants, resulting from alternative splicing at two coding exons. Evidence suggests the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.
면역원
Synthetic peptide directed towards the N terminal region of human WT1
애플리케이션
Anti-WT1 antibody produced in rabbit has been used in western blotting.
생화학적/생리학적 작용
Wilms tumor 1 (WT1) participates in the homeostasis of the adrenal glands and gonads. WT1 functions as an oncogene and its expression are observed in a majority of tumors associated with neuronal, hematopoietic, epithelial, and mesenchymal tissues. It serves as a target for cancer immune therapy. WT1 displays a tumor suppressor role in acute myeloid leukemia (AML). Mutations in the WT1 gene is also implicated in the pathophysiology of Denys-Drash syndrome (DDS) and Frasier syndrome (FS).
서열
Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Aneta A Koronowicz et al.
PPAR research, 2017, 2865283-2865283 (2017-05-02)
In our previous study, we showed that fatty acids from CLA-enriched egg yolks (EFA-CLA) reduced the proliferation of breast cancer cells; however, the molecular mechanisms of their action remain unknown. In the current study, we used MCF-7 breast cancer cell
Junhua Mao et al.
American journal of physiology. Renal physiology, 307(9), F1023-F1032 (2014-07-06)
Podocytes play a key role in the formation of cellular crescents in experimental and human diseases. However, the underlying mechanisms for podocytes in promoting crescent formation need further investigation. Here, we demonstrated that mammalian target of rapamycin complex 1 (mTORC1)
Yan Li et al.
Oncology reports, 32(6), 2680-2686 (2014-10-14)
The Wilms' tumor 1 (WT1) gene is one of the regulating factors in cell proliferation and development. It is a double-functional gene: an oncogene and a tumor suppressor. This gene was found to be highly expressed in many leukemic cell
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.