콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

MSST0018

Sigma-Aldrich

SILuLite IL6 Interleukin 6 human

recombinant, expressed in HEK 293 cells, MS protein standard

동의어(들):

B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, IL-6, Interferon beta-2 (IFN-beta-2)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
23201100
NACRES:
NA.12

생물학적 소스

human

Quality Level

재조합

expressed in HEK 293 cells

분석

≥98% (SDS-PAGE)

형태

lyophilized powder

분자량

20812.7

기술

mass spectrometry (MS): suitable

적합성

suitable for mass spectrometry (internal calibrator)

UniProt 수납 번호

저장 온도

−20°C

유전자 정보

human ... IL6(3569)

일반 설명

SILu Lite IL-6 is a recombinant human protein expressed in human 293 cells. It is a monomer of 183 amino acids, with a molecular weight of ~21 kDa. SILu Lite IL-6 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

생화학적/생리학적 작용

IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.

서열

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.