추천 제품
생물학적 소스
human
Quality Level
재조합
expressed in HEK 293 cells
분석
≥98% (SDS-PAGE)
형태
lyophilized powder
기술
mass spectrometry (MS): suitable
UniProt 수납 번호
저장 온도
−20°C
유전자 정보
human ... VEGFA(7422)
관련 카테고리
일반 설명
SILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
생화학적/생리학적 작용
VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
서열
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
물리적 형태
Supplied as a lyophilized powder containing phosphate buffered saline
법적 정보
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.