MSST0005

SILu^™Prot VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C- and ¹⁵N-labeled

• 동의어(들): SILu^™Prot Vascular endothelial growth factor A
• UNSPSC 코드: 23201100
• NACRES: NA.12

속성

• 생물학적 소스: human
• Quality Level: 200
• 재조합: expressed in HEK 293 cells
• 분석: ≥95% (SDS-PAGE)
• 형태: lyophilized powder
• 기술: mass spectrometry (MS): suitable
• UniProt 수납 번호: P15692
• 저장 온도: −20°C
• 유전자 정보: human ... VEGFA(7422)

설명

일반 설명

SILu^™ Prot VEGF165 is a recombinant, stable isotope-labeled human VEGF165 which incorporates [¹³C6,15N₄]−Arginine and [¹³C₆, ¹⁵N₂]−Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of VEGF165 by mass-spectrometry.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

생화학적/생리학적 작용

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure¹. VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration².
VEGF has also been implicated in correlation with poor prognosis in breast cancer². In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)^3,4.

서열

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice),1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable